ACRV1 anticorps (N-Term)

N° du produit ABIN633880

Détail du produit anti-ACRV1 anticorps

Antigène: ACRV1 (Acrosomal Vesicle Protein 1 (ACRV1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACRV1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ACRV1 antibody was raised against the N terminal of ACRV1

Purification: Affinity purified

Immunogène: ACRV1 antibody was raised using the N terminal of ACRV1 corresponding to a region with amino acids MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACRV1 Blocking Peptide, catalog no. 33R-6263, is also available for use as a blocking control in assays to test for specificity of this ACRV1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACRV1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACRV1

Antigène: ACRV1 (Acrosomal Vesicle Protein 1 (ACRV1))

Autre désignation: ACRV1 (ACRV1 Produits)

Synonymes: anticorps ACRV1, anticorps D11S4365, anticorps SP-10, anticorps SPACA2, anticorps Msa63, anticorps Sp10, anticorps acrosomal vesicle protein 1, anticorps ACRV1, anticorps Acrv1

Sujet: ACRV1 is a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration, and it is a potential contraceptive vaccine immunogen for humans.

Poids moléculaire: 29 kDa (MW of target protein)