Fibromodulin anticorps (N-Term)

N° du produit ABIN633883

Détail du produit anti-Fibromodulin anticorps

Antigène: Fibromodulin (FMOD)

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Fibromodulin est non-conjugé

Application: Western Blotting (WB)

Specificité: Fibromodulin antibody was raised against the N terminal of FMOD

Purification: Affinity purified

Immunogène: Fibromodulin antibody was raised using the N terminal of FMOD corresponding to a region with amino acids VYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLER

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Fibromodulin Blocking Peptide, catalog no. 33R-9917, is also available for use as a blocking control in assays to test for specificity of this Fibromodulin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FMOD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Fibromodulin

Antigène: Fibromodulin (FMOD)

Autre désignation: Fibromodulin (FMOD Produits)

Sujet: Fibromodulin is a member of a family of small interstitial proteoglycans, containing a central region composed of leucine-rich repeats with 4 keratan sulfate chains flanked by disulfide-bonded terminal domains. It may participate in the assembly of the extracellular matrix as it interacts with type I and type II collagen fibrils and inhibits fibrillogenesis in vitro. It may also regulate TGF-beta activities by sequestering TGF-beta into the extracellular matrix.

Poids moléculaire: 41 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process