LOXL1 anticorps (N-Term)

N° du produit ABIN633885

Détail du produit anti-LOXL1 anticorps

Antigène: LOXL1 (Lysyl Oxidase-Like 1 (LOXL1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LOXL1 est non-conjugé

Application: Western Blotting (WB)

Specificité: LOXL1 antibody was raised against the N terminal of LOXL1

Purification: Affinity purified

Immunogène: LOXL1 antibody was raised using the N terminal of LOXL1 corresponding to a region with amino acids RWRQLIQWENNGQVYSLLNSGSEYVPAGPQRSESSSRVLLAGAPQAQQRR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LOXL1 Blocking Peptide, catalog no. 33R-8268, is also available for use as a blocking control in assays to test for specificity of this LOXL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOXL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LOXL1

Antigène: LOXL1 (Lysyl Oxidase-Like 1 (LOXL1))

Autre désignation: LOXL1 (LOXL1 Produits)

Sujet: LOXL1 is a member of the lysyl oxidase family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family.

Poids moléculaire: 53 kDa (MW of target protein)