MRPL47 anticorps (Middle Region)

N° du produit ABIN633887

Détail du produit anti-MRPL47 anticorps

Antigène: MRPL47 (Mitochondrial Ribosomal Protein L47 (MRPL47))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MRPL47 est non-conjugé

Application: Western Blotting (WB)

Specificité: MRPL47 antibody was raised against the middle region of MRPL47

Purification: Affinity purified

Immunogène: MRPL47 antibody was raised using the middle region of MRPL47 corresponding to a region with amino acids VVQEREDALRLLQTGQERARPGAWRRDIFGRIIWHKFKQWVIPWHLNKRY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MRPL47 Blocking Peptide, catalog no. 33R-9890, is also available for use as a blocking control in assays to test for specificity of this MRPL47 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL47 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MRPL47

Antigène: MRPL47 (Mitochondrial Ribosomal Protein L47 (MRPL47))

Autre désignation: MRPL47 (MRPL47 Produits)

Synonymes: anticorps BcDNA:AT29239, anticorps CG9378, anticorps Dmel\\CG9378, anticorps MRP-L47, anticorps Rlc1, anticorps L47mt, anticorps NCM1, anticorps 4833424P18Rik, anticorps CGI-204, anticorps ENSMUSG00000051761, anticorps Gm9859, anticorps MTF/L47, anticorps MRPL47, anticorps id:ibd1090, anticorps mitochondrial ribosomal protein L47, anticorps 39S ribosomal protein L47, mitochondrial, anticorps mRpL47, anticorps MRPL47, anticorps Mrpl47, anticorps LOC413774, anticorps mrpl47

Sujet: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit.

Poids moléculaire: 17 kDa (MW of target protein)