Endonuclease G anticorps (Middle Region)
-
- Antigène Voir toutes Endonuclease G (ENDOG) Anticorps
- Endonuclease G (ENDOG)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Endonuclease G est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ENDOG antibody was raised against the middle region of ENDOG
- Purification
- Affinity purified
- Immunogène
- ENDOG antibody was raised using the middle region of ENDOG corresponding to a region with amino acids YVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGS
- Top Product
- Discover our top product ENDOG Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ENDOG Blocking Peptide, catalog no. 33R-10281, is also available for use as a blocking control in assays to test for specificity of this ENDOG antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENDOG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Endonuclease G (ENDOG)
- Autre désignation
- ENDOG (ENDOG Produits)
- Synonymes
- anticorps CG8862, anticorps Dmel\\CG8862, anticorps Tb08.10J17.140, anticorps Tb08.10J17.90, anticorps TBC1D13, anticorps endog, anticorps ENDOG, anticorps wu:fb79c08, anticorps zgc:110020, anticorps Endonuclease G, anticorps endonuclease G, anticorps putative endonuclease G, anticorps endonuclease G, mitochondrial, anticorps endonuclease G L homeolog, anticorps EndoG, anticorps Tc00.1047053506867.10, anticorps Tb927.8.4040, anticorps Tb927.8.4090, anticorps LBRM_10_0750, anticorps LMJF_10_0610, anticorps NAEGRDRAFT_78507, anticorps ENDOG, anticorps endog, anticorps eNDOG, anticorps LOC100529218, anticorps Endog, anticorps endog.L
- Sujet
- ENDOG cleaves DNA at double-stranded (DG)n.(DC)n and at single-stranded (DC)n tracts. In addition to deoxyribonuclease activities, ENDOG also has ribonuclease (RNase) and RNase H activities. ENDOG is capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA.
- Poids moléculaire
- 28 kDa (MW of target protein)
- Pathways
- Apoptose
-