OXCT1 anticorps (N-Term)

N° du produit ABIN633892

Détail du produit anti-OXCT1 anticorps

Antigène: OXCT1 (3-Oxoacid CoA Transferase 1 (OXCT1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OXCT1 est non-conjugé

Application: Western Blotting (WB)

Specificité: OXCT1 antibody was raised against the N terminal of OXCT1

Purification: Affinity purified

Immunogène: OXCT1 antibody was raised using the N terminal of OXCT1 corresponding to a region with amino acids TLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREV

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OXCT1 Blocking Peptide, catalog no. 33R-9158, is also available for use as a blocking control in assays to test for specificity of this OXCT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OXCT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OXCT1

Antigène: OXCT1 (3-Oxoacid CoA Transferase 1 (OXCT1))

Autre désignation: OXCT1 (OXCT1 Produits)

Synonymes: anticorps OXCT, anticorps oxct1, anticorps zgc:92003, anticorps wu:fj36f06, anticorps wu:fj48g08, anticorps OXCT1, anticorps oxct, anticorps scot, anticorps SCOT, anticorps 2610008O03Rik, anticorps Oxct, anticorps Oxct2a, anticorps Scot-s, anticorps 3-oxoacid CoA-transferase 1, anticorps 3-oxoacid CoA transferase 1a, anticorps 3-oxoacid CoA transferase 1, anticorps 3-oxoacid CoA-transferase 1 L homeolog, anticorps succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial, anticorps OXCT1, anticorps oxct1a, anticorps oxct1, anticorps Oxct1, anticorps oxct1.L, anticorps MONBRDRAFT_35053, anticorps LOC100414476

Sujet: OXCT1 is a member of the 3-oxoacid CoA-transferase gene family. It is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Carbohydrate Homeostasis