SPAG11B anticorps (N-Term)

N° du produit ABIN633893

Détail du produit anti-SPAG11B anticorps

Antigène: SPAG11B (Sperm Associated Antigen 11B (SPAG11B))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SPAG11B est non-conjugé

Application: Western Blotting (WB)

Specificité: SPAG11 B antibody was raised against the N terminal of SPAG11

Purification: Affinity purified

Immunogène: SPAG11 B antibody was raised using the N terminal of SPAG11 corresponding to a region with amino acids MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SPAG11B Blocking Peptide, catalog no. 33R-6377, is also available for use as a blocking control in assays to test for specificity of this SPAG11B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPAG10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SPAG11B

Antigène: SPAG11B (Sperm Associated Antigen 11B (SPAG11B))

Autre désignation: SPAG11B (SPAG11B Produits)

Sujet: SPAG11B is one of several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides.

Poids moléculaire: 15 kDa (MW of target protein)