BCKDHA anticorps (N-Term)

N° du produit ABIN633903

Détail du produit anti-BCKDHA anticorps

Antigène: BCKDHA (Branched Chain Keto Acid Dehydrogenase E1, alpha Polypeptide (BCKDHA))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BCKDHA est non-conjugé

Application: Western Blotting (WB)

Specificité: BCKDHA antibody was raised against the N terminal of BCKDHA

Purification: Affinity purified

Immunogène: BCKDHA antibody was raised using the N terminal of BCKDHA corresponding to a region with amino acids NVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BCKDHA Blocking Peptide, catalog no. 33R-6914, is also available for use as a blocking control in assays to test for specificity of this BCKDHA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCKDHA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BCKDHA

Antigène: BCKDHA (Branched Chain Keto Acid Dehydrogenase E1, alpha Polypeptide (BCKDHA))

Autre désignation: BCKDHA (BCKDHA Produits)

Synonymes: anticorps wu:fd20d04, anticorps zgc:110049, anticorps BCKDE1A, anticorps MSU, anticorps MSUD1, anticorps OVD1A, anticorps BCKDA, anticorps E1a, anticorps 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial, anticorps branched chain keto acid dehydrogenase E1, alpha polypeptide, anticorps 2-oxoisovalerate dehydrogenase alpha subunit (branched-chain alpha-keto acid dehydrogenase E1 component alpha chain) (BCKDH E1-alpha) (BCKDE1A), anticorps branched chain ketoacid dehydrogenase E1, alpha polypeptide, anticorps LOC704978, anticorps bckdha, anticorps BCKDHA, anticorps BckdhA, anticorps Bckdha

Sujet: The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO2. It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).

Poids moléculaire: 50 kDa (MW of target protein)