CPE anticorps (N-Term)
-
- Antigène Voir toutes CPE Anticorps
- CPE (Carboxypeptidase E (CPE))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CPE est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Carboxypeptidase E antibody was raised against the N terminal of CPE
- Purification
- Affinity purified
- Immunogène
- Carboxypeptidase E antibody was raised using the N terminal of CPE corresponding to a region with amino acids GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG
- Top Product
- Discover our top product CPE Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Carboxypeptidase E Blocking Peptide, catalog no. 33R-3440, is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase E antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPE antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CPE (Carboxypeptidase E (CPE))
- Autre désignation
- Carboxypeptidase E (CPE Produits)
- Synonymes
- anticorps CPE, anticorps CPH, anticorps Cph-1, anticorps Cph1, anticorps R74677, anticorps fat, anticorps CARBE, anticorps Cph, anticorps si:ch211-198g9.2, anticorps zgc:85981, anticorps carboxypeptidase E, anticorps carboxypeptidase E L homeolog, anticorps CPE, anticorps cpe, anticorps Cpe, anticorps cpe.L
- Sujet
- CPE is a carboxypeptidase that cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. It is a peripheral membrane protein. The protein specifically binds regulated secretory pathway proteins, including prohormones, but not constitutively secreted proteins.
- Poids moléculaire
- 52 kDa (MW of target protein)
- Pathways
- Peptide Hormone Metabolism, Synaptic Membrane
-