CPE anticorps (N-Term)

N° du produit ABIN633904

Détail du produit anti-CPE anticorps

Antigène: CPE (Carboxypeptidase E (CPE))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CPE est non-conjugé

Application: Western Blotting (WB)

Specificité: Carboxypeptidase E antibody was raised against the N terminal of CPE

Purification: Affinity purified

Immunogène: Carboxypeptidase E antibody was raised using the N terminal of CPE corresponding to a region with amino acids GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Carboxypeptidase E Blocking Peptide, catalog no. 33R-3440, is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase E antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CPE

Antigène: CPE (Carboxypeptidase E (CPE))

Autre désignation: Carboxypeptidase E (CPE Produits)

Sujet: CPE is a carboxypeptidase that cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. It is a peripheral membrane protein. The protein specifically binds regulated secretory pathway proteins, including prohormones, but not constitutively secreted proteins.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism, Synaptic Membrane