GFRA2 anticorps (C-Term)
-
- Antigène Voir toutes GFRA2 Anticorps
- GFRA2 (GDNF Family Receptor alpha 2 (GFRA2))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GFRA2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GFRA2 antibody was raised against the C terminal of GFRA2
- Purification
- Affinity purified
- Immunogène
- GFRA2 antibody was raised using the C terminal of GFRA2 corresponding to a region with amino acids NVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLK
- Top Product
- Discover our top product GFRA2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GFRA2 Blocking Peptide, catalog no. 33R-6924, is also available for use as a blocking control in assays to test for specificity of this GFRA2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GFRA2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GFRA2 (GDNF Family Receptor alpha 2 (GFRA2))
- Autre désignation
- GFRA2 (GFRA2 Produits)
- Synonymes
- anticorps GDNFRB, anticorps NRTNR-ALPHA, anticorps NTNRA, anticorps RETL2, anticorps TRNR2, anticorps Retl2, anticorps NTNRALPHA, anticorps ntnra, anticorps retl2, anticorps trnr2, anticorps gdnfrb, anticorps nrtnr-alpha, anticorps gfra2, anticorps GDNF family receptor alpha 2, anticorps glial cell line derived neurotrophic factor family receptor alpha 2, anticorps GDNF family receptor alpha 2a, anticorps GFRA2, anticorps Gfra2, anticorps gfra2, anticorps gfra2a
- Sujet
- Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. GFRA2 is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This encoded protein acts preferentially as a receptor for NTN compared to its other family member, GDNF family receptor alpha 1.
- Poids moléculaire
- 47 kDa (MW of target protein)
-