XPNPEP2 anticorps

N° du produit ABIN633909

Détail du produit anti-XPNPEP2 anticorps

Antigène: XPNPEP2 (X-Prolyl Aminopeptidase (Aminopeptidase P) 2, Membrane-Bound (XPNPEP2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp XPNPEP2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: XPNPEP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

XPNPEP2 Blocking Peptide, catalog no. 33R-7464, is also available for use as a blocking control in assays to test for specificity of this XPNPEP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XPNPEP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur XPNPEP2

Antigène: XPNPEP2 (X-Prolyl Aminopeptidase (Aminopeptidase P) 2, Membrane-Bound (XPNPEP2))

Autre désignation: XPNPEP2 (XPNPEP2 Produits)

Synonymes: anticorps APP2, anticorps 9030008G12Rik, anticorps mAPP, anticorps XPNPEP2, anticorps zK61O11.1, anticorps zgc:63528, anticorps X-prolyl aminopeptidase 2, anticorps X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound, anticorps X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound L homeolog, anticorps XPNPEP2, anticorps Xpnpep2, anticorps xpnpep2.L, anticorps xpnpep2

Sujet: Aminopeptidase P is a hydrolase specific for N-terminal imido bonds, which are common to several collagen degradation products, neuropeptides, vasoactive peptides, and cytokines. Structurally, the enzyme is a member of the 'pita bread fold' family and occurs in mammalian tissues in both soluble and GPI-anchored membrane-bound forms. A membrane-bound and soluble form of this enzyme has been identified as products of two separate genes.

Poids moléculaire: 75 kDa (MW of target protein)