UGCGL2 anticorps (N-Term)

N° du produit ABIN633912

Détail du produit anti-UGCGL2 anticorps

Antigène: UGCGL2 (UGT2) (UDP-Glucose Glycoprotein Glucosyltransferase 2 (UGT2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UGCGL2 est non-conjugé

Application: Western Blotting (WB)

Specificité: UGCGL2 antibody was raised against the N terminal of µgCGL2

Purification: Affinity purified

Immunogène: UGCGL2 antibody was raised using the N terminal of µgCGL2 corresponding to a region with amino acids KHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UGCGL2 Blocking Peptide, catalog no. 33R-4422, is also available for use as a blocking control in assays to test for specificity of this µgCGL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgCGL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UGCGL2

Antigène: UGCGL2 (UGT2) (UDP-Glucose Glycoprotein Glucosyltransferase 2 (UGT2))

Autre désignation: UGCGL2 (UGT2 Produits)

Synonymes: anticorps UGCGL2, anticorps ugcgl2, anticorps im:7146988, anticorps wu:fi13a08, anticorps HUGT2, anticorps UGT2, anticorps 1810064L21Rik, anticorps 3110001A05Rik, anticorps 3110027P15Rik, anticorps A230065J02Rik, anticorps AW047562, anticorps Ugcgl2, anticorps UDP-glucose glycoprotein glucosyltransferase 2, anticorps UGGT2, anticorps uggt2, anticorps Uggt2

Sujet: UGCGL2 recognises glycoproteins with minor folding defects. UGCGL2 reglucosylates single N-glycans near the misfolded part of the protein, thus providing quality control for protein folding in the endoplasmic reticulum. Reglucosylated proteins are recognised by calreticulin for recycling to the endoplasmic reticulum and refolding or degradation.

Poids moléculaire: 172 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome