PRELP anticorps (Middle Region)
-
- Antigène Voir toutes PRELP Anticorps
- PRELP (Proline Arginine Rich End Leucine Rich Repeat Protein (PRELP))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PRELP est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PRELP antibody was raised against the middle region of PRELP
- Purification
- Affinity purified
- Immunogène
- PRELP antibody was raised using the middle region of PRELP corresponding to a region with amino acids SNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLSH
- Top Product
- Discover our top product PRELP Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PRELP Blocking Peptide, catalog no. 33R-8653, is also available for use as a blocking control in assays to test for specificity of this PRELP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRELP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PRELP (Proline Arginine Rich End Leucine Rich Repeat Protein (PRELP))
- Autre désignation
- PRELP (PRELP Produits)
- Synonymes
- anticorps 7330409J17Rik, anticorps SLRR2A, anticorps MST161, anticorps MSTP161, anticorps proline arginine-rich end leucine-rich repeat, anticorps proline and arginine rich end leucine rich repeat protein, anticorps Prelp, anticorps PRELP
- Sujet
- PRELP is a leucine-rich repeat protein present in connective tissue extracellular matrix. This protein functions as a molecule anchoring basement membranes to the underlying connective tissue. This protein has been shown to bind type I collagen to basement membranes and type II collagen to cartilage. It also binds the basement membrane heparan sulfate proteoglycan perlecan. This protein is suggested to be involved in the pathogenesis of Hutchinson-Gilford progeria (HGP), which is reported to lack the binding of collagen in basement membranes and cartilage.
- Poids moléculaire
- 42 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-