ART5 anticorps (Middle Region)
-
- Antigène Voir toutes ART5 Anticorps
- ART5 (ADP-Ribosyltransferase 5 (ART5))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ART5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ART5 antibody was raised against the middle region of ART5
- Purification
- Affinity purified
- Immunogène
- ART5 antibody was raised using the middle region of ART5 corresponding to a region with amino acids VFPKEREVLIPPHEVFLVTRFSQDGAQSLVTLWSYNQTCSHFNCAYLGGE
- Top Product
- Discover our top product ART5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ART5 Blocking Peptide, catalog no. 33R-9536, is also available for use as a blocking control in assays to test for specificity of this ART5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ART5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ART5 (ADP-Ribosyltransferase 5 (ART5))
- Autre désignation
- ART5 (ART5 Produits)
- Synonymes
- anticorps ARTC5, anticorps Yac-2, anticorps ART5, anticorps Art5, anticorps art5, anticorps ADP-ribosyltransferase 5, anticorps ecto-ADP-ribosyltransferase 5-like, anticorps ecto-ADP-ribosyltransferase 5, anticorps ADP-ribosyltransferase 5 L homeolog, anticorps ART5, anticorps Art5, anticorps LOC618664, anticorps LOC100715378, anticorps art5.L
- Sujet
- The protein encoded by this gene belongs to the ARG-specific ADP-ribosyltransferase family. Proteins in this family regulate the function of target proteins by attaching ADP-ribose to specific amino acid residues in their target proteins. The mouse homolog lacks a glycosylphosphatidylinositol-anchor signal sequence and is predicted to be a secretory enzyme. Transcript variants with different 5' UTRs, but encoding the same protein have been found for this gene.
- Poids moléculaire
- 30 kDa (MW of target protein)
-