EPHX1 anticorps
-
- Antigène Voir toutes EPHX1 Anticorps
- EPHX1 (Epoxide Hydrolase 1, Microsomal (Xenobiotic) (EPHX1))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EPHX1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- EPHX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLI
- Top Product
- Discover our top product EPHX1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EPHX1 Blocking Peptide, catalog no. 33R-1773, is also available for use as a blocking control in assays to test for specificity of this EPHX1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPHX1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EPHX1 (Epoxide Hydrolase 1, Microsomal (Xenobiotic) (EPHX1))
- Autre désignation
- EPHX1 (EPHX1 Produits)
- Synonymes
- anticorps NV13267, anticorps DRB1, anticorps DSRNA-BINDING PROTEIN 1, anticorps F21M12.9, anticorps F21M12_9, anticorps HYPONASTIC LEAVES 1, anticorps AI195553, anticorps Eph-1, anticorps Eph1, anticorps mEH, anticorps EPHX, anticorps EPOX, anticorps HYL1, anticorps MEH, anticorps zgc:56126, anticorps ephx, anticorps epox, anticorps meh, anticorps MEH8, anticorps epoxide hydrolase 1, anticorps epoxide hydrolase 1, microsomal (xenobiotic), anticorps Epoxide hydrolase 1, anticorps dsRNA-binding domain-like superfamily protein, anticorps epoxide hydrolase 1, microsomal, anticorps epoxide hydrolase 1, microsomal (xenobiotic) L homeolog, anticorps EPHX1, anticorps Eh1, anticorps hyep, anticorps HYL1, anticorps Ephx1, anticorps ephx1, anticorps ephx1.L
- Sujet
- Epoxide hydrolase is a critical biotransformation enzyme that converts epoxides from the degradation of aromatic compounds to trans-dihydrodiols which can be conjugated and excreted from the body. Epoxide hydrolase functions in both the activation and detoxification of epoxides. Mutations in this gene cause preeclampsia, epoxide hydrolase deficiency or increased epoxide hydrolase activity.
- Poids moléculaire
- 53 kDa (MW of target protein)
-