SMPDL3B anticorps (N-Term)
-
- Antigène Voir toutes SMPDL3B Anticorps
- SMPDL3B (Sphingomyelin phosphodiesterase, Acid-Like 3B (SMPDL3B))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SMPDL3B est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- SMPDL3 B antibody was raised against the N terminal of SMPDL3
- Purification
- Affinity purified
- Immunogène
- SMPDL3 B antibody was raised using the N terminal of SMPDL3 corresponding to a region with amino acids ILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDF
- Top Product
- Discover our top product SMPDL3B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SMPDL3B Blocking Peptide, catalog no. 33R-4064, is also available for use as a blocking control in assays to test for specificity of this SMPDL3B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMPDL0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SMPDL3B (Sphingomyelin phosphodiesterase, Acid-Like 3B (SMPDL3B))
- Autre désignation
- SMPDL3B (SMPDL3B Produits)
- Sujet
- Located on chromosome 1, this gene encodes for acid sphingomyelinase-like phosphodiesterase 3b precursor protein.
- Poids moléculaire
- 52 kDa (MW of target protein)
-