WFDC5 anticorps (N-Term)

N° du produit ABIN633949

Détail du produit anti-WFDC5 anticorps

Antigène: WFDC5 (WAP Four-Disulfide Core Domain 5 (WFDC5))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WFDC5 est non-conjugé

Application: Western Blotting (WB)

Specificité: WFDC5 antibody was raised against the N terminal of WFDC5

Purification: Affinity purified

Immunogène: WFDC5 antibody was raised using the N terminal of WFDC5 corresponding to a region with amino acids MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WFDC5 Blocking Peptide, catalog no. 33R-6386, is also available for use as a blocking control in assays to test for specificity of this WFDC5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WFDC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WFDC5

Antigène: WFDC5 (WAP Four-Disulfide Core Domain 5 (WFDC5))

Autre désignation: WFDC5 (WFDC5 Produits)

Synonymes: anticorps Prg5, anticorps Wap1, anticorps BC019734, anticorps PRG5, anticorps WAP1, anticorps dJ211D12.5, anticorps WAP four-disulfide core domain 5, anticorps Wfdc5, anticorps WFDC5

Sujet: This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. Most WFDC proteins contain only one WFDC domain, and this encoded protein contains two WFDC domains. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster.

Poids moléculaire: 11 kDa (MW of target protein)