FUT6 anticorps (C-Term)

N° du produit ABIN633952

Détail du produit anti-FUT6 anticorps

Antigène: FUT6 (Fucosyltransferase 6 (Alpha (1,3) Fucosyltransferase) (FUT6))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FUT6 est non-conjugé

Application: Western Blotting (WB)

Specificité: FUT6 antibody was raised against the C terminal of FUT6

Purification: Affinity purified

Immunogène: FUT6 antibody was raised using the C terminal of FUT6 corresponding to a region with amino acids YITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLAR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FUT6 Blocking Peptide, catalog no. 33R-10142, is also available for use as a blocking control in assays to test for specificity of this FUT6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FUT6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FUT6

Antigène: FUT6 (Fucosyltransferase 6 (Alpha (1,3) Fucosyltransferase) (FUT6))

Autre désignation: FUT6 (FUT6 Produits)

Synonymes: anticorps FCT3A, anticorps FT1A, anticorps Fuc-TVI, anticorps FucT-VI, anticorps FUT3, anticorps fut, anticorps FUT, anticorps FUTB, anticorps ATFUT6, anticorps F7A19.16, anticorps F7A19_16, anticorps fucosyltransferase 6, anticorps fut6, anticorps fucosyltransferase 6, anticorps fucosyltransferase 6 S homeolog, anticorps FUT6, anticorps fut6.S

Sujet: FUT6 is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. Two transcript variants encoding the same protein have been found for this gene.

Poids moléculaire: 42 kDa (MW of target protein)