Plexin A4 anticorps (Middle Region)
-
- Antigène Voir toutes Plexin A4 (PLXNA4) Anticorps
- Plexin A4 (PLXNA4)
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Plexin A4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Plexin A4 antibody was raised against the middle region of PLXNA4
- Purification
- Affinity purified
- Immunogène
- Plexin A4 antibody was raised using the middle region of PLXNA4 corresponding to a region with amino acids TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRVQPLLCCFLNV
- Top Product
- Discover our top product PLXNA4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Plexin A4 Blocking Peptide, catalog no. 33R-9241, is also available for use as a blocking control in assays to test for specificity of this Plexin A4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLXNA4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Plexin A4 (PLXNA4)
- Autre désignation
- Plexin A4 (PLXNA4 Produits)
- Synonymes
- anticorps D204, anticorps wu:fd49b01, anticorps wu:fe15f03, anticorps PLXNA4A, anticorps FAYV2820, anticorps PLEXA4, anticorps PLXNA4B, anticorps PRO34003, anticorps 9330117B14, anticorps Plxa4, anticorps mKIAA1550, anticorps PLEX2, anticorps Plxna4, anticorps PLXNA4, anticorps plexin A4, anticorps plexin-A4, anticorps plxna4, anticorps PLXNA4, anticorps LOC100467706, anticorps Plxna4
- Sujet
- This protein mediates semaphorin receptor activity.
- Poids moléculaire
- 57 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-