Calreticulin 3 anticorps (N-Term)
-
- Antigène Voir toutes Calreticulin 3 (CALR3) Anticorps
- Calreticulin 3 (CALR3)
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Calreticulin 3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Calreticulin 3 antibody was raised against the N terminal of CALR3
- Purification
- Affinity purified
- Immunogène
- Calreticulin 3 antibody was raised using the N terminal of CALR3 corresponding to a region with amino acids MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEK
- Top Product
- Discover our top product CALR3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Calreticulin 3 Blocking Peptide, catalog no. 33R-5666, is also available for use as a blocking control in assays to test for specificity of this Calreticulin 3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CALR3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Calreticulin 3 (CALR3)
- Autre désignation
- Calreticulin 3 (CALR3 Produits)
- Synonymes
- anticorps 1700031L01Rik, anticorps 6330586I20Rik, anticorps Crt2, anticorps cspn, anticorps CMH19, anticorps CRT2, anticorps CT93, anticorps A. thaliana calreticulin 3, anticorps AtCRT3, anticorps CALRETICULIN 3, anticorps EBS2, anticorps EMS-MUTAGENIZED BRI1 SUPPRESSOR 2, anticorps PRIORITY IN SWEET LIFE 1, anticorps PSL1, anticorps T27G7.13, anticorps T27G7_13, anticorps calreticulin 3, anticorps CALR, anticorps calreticulin 3, anticorps CALR3, anticorps Calr3, anticorps CRT3
- Sujet
- Calreticulins, such as CALR3, are Ca(2+)-binding chaperones localized mainly in the endoplasmic/sarcoplasmic reticulum.
- Poids moléculaire
- 42 kDa (MW of target protein)
- Pathways
- Activation of Innate immune Response
-