A1BG anticorps (N-Term)
-
- Antigène Voir toutes A1BG Anticorps
- A1BG (alpha-1-B Glycoprotein (A1BG))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp A1BG est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- A1 BG antibody was raised against the N terminal of A1 G
- Purification
- Affinity purified
- Immunogène
- A1 BG antibody was raised using the N terminal of A1 G corresponding to a region with amino acids MAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATF
- Top Product
- Discover our top product A1BG Anticorps primaire
-
-
- Indications d'application
-
WB: 0.1 µg/mL
Optimal conditions should be determined by the investigator. - Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 G antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- A1BG (alpha-1-B Glycoprotein (A1BG))
- Autre désignation
- A1BG (A1BG Produits)
- Synonymes
- anticorps A1B, anticorps ABG, anticorps GAB, anticorps HYST2477, anticorps A1BG, anticorps C44, anticorps alpha-1-B glycoprotein, anticorps A1BG, anticorps A1bg
- Sujet
- A1BG is a plasma glycoprotein of unknown function. It shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins.
- Poids moléculaire
- 54 kDa (MW of target protein)
-