ANGPTL5 anticorps (N-Term)

N° du produit ABIN633977

Détail du produit anti-ANGPTL5 anticorps

Antigène: ANGPTL5 (Angiopoietin-Like 5 (ANGPTL5))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ANGPTL5 est non-conjugé

Application: Western Blotting (WB)

Specificité: ANGPTL5 antibody was raised against the N terminal of ANGPTL5

Purification: Affinity purified

Immunogène: ANGPTL5 antibody was raised using the N terminal of ANGPTL5 corresponding to a region with amino acids ASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ANGPTL5 Blocking Peptide, catalog no. 33R-1512, is also available for use as a blocking control in assays to test for specificity of this ANGPTL5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANGPTL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ANGPTL5

Antigène: ANGPTL5 (Angiopoietin-Like 5 (ANGPTL5))

Autre désignation: ANGPTL5 (ANGPTL5 Produits)

Synonymes: anticorps AGF, anticorps ARP5, anticorps ANGPTL5, anticorps bZ1P14.8, anticorps wu:fe36e01, anticorps si:rp71-1p14.8, anticorps angiopoietin like 5, anticorps angiopoietin like 6, anticorps angiopoietin-like 5, anticorps ANGPTL5, anticorps ANGPTL6, anticorps angptl5, anticorps Angptl5

Sujet: The function of ANGPTL5 has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 44 kDa (MW of target protein)