FCN1 anticorps
-
- Antigène Voir toutes FCN1 Anticorps
- FCN1 (Ficolin (Collagen/fibrinogen Domain Containing) 1 (FCN1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FCN1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- FCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEA
- Top Product
- Discover our top product FCN1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FCN1 Blocking Peptide, catalog no. 33R-3578, is also available for use as a blocking control in assays to test for specificity of this FCN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FCN1 (Ficolin (Collagen/fibrinogen Domain Containing) 1 (FCN1))
- Autre désignation
- FCN1 (FCN1 Produits)
- Synonymes
- anticorps FCNM, anticorps FCNB, anticorps FCN2, anticorps FCN1, anticorps ficolin 1, anticorps ficolin (collagen/fibrinogen domain containing) 1, anticorps ficolin-1, anticorps FCN1, anticorps Fcn1, anticorps LOC100069029
- Sujet
- The ficolin family of proteins are characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. The collagen-like and the fibrinogen-like domains are also found separately in other proteins such as complement protein C1q, C-type lectins known as collectins, and tenascins. However, all these proteins recognise different targets, and are functionally distinct. Ficolin 1(FCN1) is predominantly expressed in the peripheral blood leukocytes, and has been postulated to function as a plasma protein with elastin-binding activity.
- Poids moléculaire
- 32 kDa (MW of target protein)
- Pathways
- Système du Complément
-