Nucleobindin 1 anticorps (C-Term)

N° du produit ABIN633980

Détail du produit anti-Nucleobindin 1 anticorps

Antigène: Nucleobindin 1 (NUCB1)

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Nucleobindin 1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Nucleobindin 1 antibody was raised against the C terminal of NUCB1

Purification: Affinity purified

Immunogène: Nucleobindin 1 antibody was raised using the C terminal of NUCB1 corresponding to a region with amino acids PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Nucleobindin 1 Blocking Peptide, catalog no. 33R-6951, is also available for use as a blocking control in assays to test for specificity of this Nucleobindin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUCB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Nucleobindin 1

Antigène: Nucleobindin 1 (NUCB1)

Autre désignation: Nucleobindin 1 (NUCB1 Produits)

Synonymes: anticorps nuc, anticorps MGC69294, anticorps MGC81496, anticorps NUCB1, anticorps zgc:153192, anticorps DKFZp459O1814, anticorps B230337F23Rik, anticorps C77483, anticorps Calnuc, anticorps MTEST82, anticorps Nucb, anticorps CALNUC, anticorps NUC, anticorps nucleobindin 1, anticorps nucleobindin 1 S homeolog, anticorps nucb1, anticorps nucb1.S, anticorps NUCB1, anticorps Nucb1

Sujet: Nucleobindin, also known as calnuc, participates in Ca2+ storage in the Golgi, as well as in other biological processes that involve DNA-binding and protein-protein interactions.

Poids moléculaire: 54 kDa (MW of target protein)