RDH11 anticorps

N° du produit ABIN633983

Détail du produit anti-RDH11 anticorps

Antigène: RDH11 (Retinol Dehydrogenase 11 (All-Trans/9-Cis/11-Cis) (RDH11))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RDH11 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RDH11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIAR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RDH11 Blocking Peptide, catalog no. 33R-8425, is also available for use as a blocking control in assays to test for specificity of this RDH11 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDH11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RDH11

Antigène: RDH11 (Retinol Dehydrogenase 11 (All-Trans/9-Cis/11-Cis) (RDH11))

Autre désignation: RDH11 (RDH11 Produits)

Synonymes: anticorps RDH11, anticorps 2610319N22Rik, anticorps AI428145, anticorps AU045252, anticorps Arsdr1, anticorps C85936, anticorps CGI-82, anticorps HCBP12, anticorps M42C60, anticorps Mdt1, anticorps Psdr1, anticorps SCALD, anticorps UBE-1c1, anticorps Ube-1c, anticorps ARSDR1, anticorps CGI82, anticorps MDT1, anticorps PSDR1, anticorps RALR1, anticorps SDR7C1, anticorps retinol dehydrogenase 11 (all-trans/9-cis/11-cis) S homeolog, anticorps retinol dehydrogenase 11 (all-trans/9-cis/11-cis), anticorps retinol dehydrogenase 11, anticorps rdh11.S, anticorps RDH11, anticorps Rdh11

Sujet: RHD11, a member of the short-chain dehydrogenase/reductase (SDR) superfamily of oxidoreductases, is expressed at high levels in prostate epithelium, and its expression is regulated by androgens.RHD11, a member of the short-chain dehydrogenase/reductase (SDR) superfamily of oxidoreductases, is expressed at high levels in prostate epithelium, and its expression is regulated by androgens.

Poids moléculaire: 35 kDa (MW of target protein)