APOH anticorps
-
- Antigène Voir toutes APOH Anticorps
- APOH (Apolipoprotein H (Beta-2-Glycoprotein I) (APOH))
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp APOH est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ApoH antibody was raised using a synthetic peptide corresponding to a region with amino acids LWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGAD
- Top Product
- Discover our top product APOH Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ApoH Blocking Peptide, catalog no. 33R-5558, is also available for use as a blocking control in assays to test for specificity of this ApoH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- APOH (Apolipoprotein H (Beta-2-Glycoprotein I) (APOH))
- Autre désignation
- ApoH (APOH Produits)
- Synonymes
- anticorps B2G1, anticorps B2GP1, anticorps BG, anticorps BETA2, anticorps BHF-1, anticorps MODY6, anticorps NEUROD, anticorps bHLHa3, anticorps apoh, anticorps APOH, anticorps B2GPI, anticorps beta-2-GPI, anticorps beta2-GPI, anticorps LOC100227913, anticorps apolipoprotein H, anticorps neuronal differentiation 1, anticorps APOH, anticorps NEUROD1, anticorps apoh, anticorps Apoh
- Sujet
- Apolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome, but it does not seem to be required for the reactivity of antiphospholipid autoantibodies associated with infections.
- Poids moléculaire
- 36 kDa (MW of target protein)
-