FETUB anticorps (N-Term)
-
- Antigène Voir toutes FETUB Anticorps
- FETUB (Fetuin B (FETUB))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FETUB est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FETUB antibody was raised against the N terminal of FETUB
- Purification
- Affinity purified
- Immunogène
- FETUB antibody was raised using the N terminal of FETUB corresponding to a region with amino acids GCNDSDVLAVAGFALRDINKDRKDGYVLRLNRVNDAQEYRRGGLGSLFYL
- Top Product
- Discover our top product FETUB Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FETUB Blocking Peptide, catalog no. 33R-3189, is also available for use as a blocking control in assays to test for specificity of this FETUB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FETUB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FETUB (Fetuin B (FETUB))
- Autre désignation
- FETUB (FETUB Produits)
- Sujet
- The protein encoded by this gene is a member of the fetuin family, part of the cystatin superfamily of cysteine protease inhibitors. Fetuins have been implicated in several diverse functions, including osteogenesis and bone resorption.
- Poids moléculaire
- 42 kDa (MW of target protein)
-