FETUB anticorps (N-Term)

N° du produit ABIN633997

Détail du produit anti-FETUB anticorps

Antigène: FETUB (Fetuin B (FETUB))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FETUB est non-conjugé

Application: Western Blotting (WB)

Specificité: FETUB antibody was raised against the N terminal of FETUB

Purification: Affinity purified

Immunogène: FETUB antibody was raised using the N terminal of FETUB corresponding to a region with amino acids GCNDSDVLAVAGFALRDINKDRKDGYVLRLNRVNDAQEYRRGGLGSLFYL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FETUB Blocking Peptide, catalog no. 33R-3189, is also available for use as a blocking control in assays to test for specificity of this FETUB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FETUB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FETUB

Antigène: FETUB (Fetuin B (FETUB))

Autre désignation: FETUB (FETUB Produits)

Synonymes: anticorps 16G2, anticorps Gugu, anticorps IRL685, anticorps Fet, anticorps Pp63, anticorps gugu, anticorps fetuin-b, anticorps FETUB, anticorps 16g2, anticorps irl685, anticorps im:6910148, anticorps 2310011O17Rik, anticorps AI255764, anticorps D17980, anticorps fetuin B, anticorps fetuin B L homeolog, anticorps fetuin beta, anticorps FETUB, anticorps Fetub, anticorps fetub.L, anticorps fetub

Sujet: The protein encoded by this gene is a member of the fetuin family, part of the cystatin superfamily of cysteine protease inhibitors. Fetuins have been implicated in several diverse functions, including osteogenesis and bone resorption.

Poids moléculaire: 42 kDa (MW of target protein)