FUCA1 anticorps (Middle Region)

N° du produit ABIN634001

Détail du produit anti-FUCA1 anticorps

Antigène: FUCA1 (Fucosidase, alpha-L- 1, Tissue (FUCA1))

Épitope: Middle Region

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FUCA1 est non-conjugé

Application: Western Blotting (WB)

Specificité: FUCA1 antibody was raised against the middle region of FUCA1

Purification: Affinity purified

Immunogène: FUCA1 antibody was raised using the middle region of FUCA1 corresponding to a region with amino acids TNWPSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYGLYHSLLEWFHPL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FUCA1 Blocking Peptide, catalog no. 33R-9215, is also available for use as a blocking control in assays to test for specificity of this FUCA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FUCA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FUCA1

Antigène: FUCA1 (Fucosidase, alpha-L- 1, Tissue (FUCA1))

Autre désignation: FUCA1 (FUCA1 Produits)

Synonymes: anticorps FUCA, anticorps FUCA1, anticorps 0610006A03Rik, anticorps 9530055J05Rik, anticorps Afuc, anticorps Fuca, anticorps fuca, anticorps fuca1, anticorps ATFUC1, anticorps F24D13.11, anticorps F24D13_11, anticorps alpha-L-fucosidase 1, anticorps wu:fb02a09, anticorps zgc:101116, anticorps alpha-L-fucosidase 1, anticorps fucosidase, alpha-L- 1, tissue, anticorps alpha-L-fucosidase 1 L homeolog, anticorps alpha-L-fucosidase 1, tandem duplicate 2, anticorps FUCA1, anticorps Fuca1, anticorps fuca1.L, anticorps fuca1, anticorps FUC1, anticorps LOC9317020, anticorps LOC100285202, anticorps fuca1.2

Sujet: Alpha-L-fucosidase (EC 3.2.1.51) is a lysosomal enzyme involved in the degradation of fucose-containing glycoproteins and glycolipids. At least 2 separate polymorphic alpha-L-fucosidases are recognised in man.

Poids moléculaire: 54 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process