IFNA7 anticorps (N-Term)

N° du produit ABIN634003

Détail du produit anti-IFNA7 anticorps

Antigène: IFNA7 (IFNa7) (Interferon, alpha 7 (IFNa7))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IFNA7 est non-conjugé

Application: Western Blotting (WB)

Specificité: IFN Alpha 7 antibody was raised against the N terminal of IFNA7

Purification: Affinity purified

Immunogène: IFN Alpha 7 antibody was raised using the N terminal of IFNA7 corresponding to a region with amino acids RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IFN Alpha 7 Blocking Peptide, catalog no. 33R-7815, is also available for use as a blocking control in assays to test for specificity of this IFN Alpha 7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFNA7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IFNA7

Antigène: IFNA7 (IFNa7) (Interferon, alpha 7 (IFNa7))

Autre désignation: IFN alpha 7 (IFNa7 Produits)

Synonymes: anticorps CaIFN-alpha 7, anticorps Ifa7, anticorps IFN-alphaJ, anticorps IFNA-J, anticorps interferon, alpha 7, anticorps interferon alpha-7, anticorps interferon alpha 7, anticorps IFNA7, anticorps LOC741747, anticorps Ifna7

Sujet: IFNA7 belongs to the alpha/beta interferon family. IFNA7 is produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Signalistation JAK/STAT, Hepatitis C