Chymotrypsin anticorps (N-Term)
-
- Antigène Voir toutes Chymotrypsin (CTRL) Anticorps
- Chymotrypsin (CTRL)
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Chymotrypsin est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Chymotrypsin-Like antibody was raised against the N terminal of CTRL
- Purification
- Affinity purified
- Immunogène
- Chymotrypsin-Like antibody was raised using the N terminal of CTRL corresponding to a region with amino acids SQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNS
- Top Product
- Discover our top product CTRL Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Chymotrypsin-Like Blocking Peptide, catalog no. 33R-8727, is also available for use as a blocking control in assays to test for specificity of this Chymotrypsin-Like antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTRL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Chymotrypsin (CTRL)
- Autre désignation
- Chymotrypsin-Like (CTRL Produits)
- Synonymes
- anticorps 0910001G08Rik, anticorps 1810004D15Rik, anticorps AV005227, anticorps Ctra-1, anticorps Ctra1, anticorps chymopasin, anticorps mFLJ00366, anticorps CTRL1, anticorps chymotrypsin-like, anticorps chymotrypsin like, anticorps Ctrl, anticorps CTRL
- Classe de substances
- Chemical
- Sujet
- CTRL possesses serine-type endopeptidase activity.
- Poids moléculaire
- 28 kDa (MW of target protein)
-