DAO anticorps (C-Term)

N° du produit ABIN634013

Détail du produit anti-DAO anticorps

Antigène: DAO (ABP1) (Amiloride Binding Protein 1 (Amine Oxidase (Copper-Containing)) (ABP1))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DAO est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: ABP1 antibody was raised against the C terminal of ABP1

Purification: Affinity purified

Immunogène: ABP1 antibody was raised using the C terminal of ABP1 corresponding to a region with amino acids QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ABP1 Blocking Peptide, catalog no. 33R-7547, is also available for use as a blocking control in assays to test for specificity of this ABP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DAO

Antigène: DAO (ABP1) (Amiloride Binding Protein 1 (Amine Oxidase (Copper-Containing)) (ABP1))

Autre désignation: ABP1 (ABP1 Produits)

Synonymes: anticorps ABP, anticorps ABP1, anticorps DAO, anticorps DAO1, anticorps KAO, anticorps 1600012D06Rik, anticorps Abp1, anticorps abp1, anticorps si:ch211-286c5.2, anticorps zgc:154101, anticorps Abp, anticorps dao, anticorps amine oxidase, copper containing 1, anticorps amine oxidase, copper-containing 1, anticorps AOC1, anticorps Aoc1, anticorps aoc1

Sujet: ABP1 is a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels.

Poids moléculaire: 83 kDa (MW of target protein)