ZG16 anticorps (Middle Region)

N° du produit ABIN634014

Détail du produit anti-ZG16 anticorps

Antigène: ZG16 (Zymogen Granule Protein 16 (ZG16))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZG16 est non-conjugé

Application: Western Blotting (WB)

Specificité: ZG16 antibody was raised against the middle region of ZG16

Purification: Affinity purified

Immunogène: ZG16 antibody was raised using the middle region of ZG16 corresponding to a region with amino acids WSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZG16 Blocking Peptide, catalog no. 33R-10009, is also available for use as a blocking control in assays to test for specificity of this ZG16 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZG16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZG16

Antigène: ZG16 (Zymogen Granule Protein 16 (ZG16))

Autre désignation: ZG16 (ZG16 Produits)

Synonymes: anticorps JCLN, anticorps JCLN1, anticorps ZG16A, anticorps Zg-16p, anticorps Zg16p, anticorps 1810010M01Rik, anticorps AI593689, anticorps ZG16p, anticorps zymogen granule protein 16, anticorps ZG16, anticorps Zg16

Sujet: ZG16 may act as a linker molecule between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins during granule formation in the TGN.

Poids moléculaire: 18 kDa (MW of target protein)