EPX anticorps (Middle Region)

N° du produit ABIN634017

Détail du produit anti-EPX anticorps

Antigène: EPX (Eosinophil Peroxidase (EPX))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EPX est non-conjugé

Application: Western Blotting (WB)

Specificité: EPX antibody was raised against the middle region of EPX

Purification: Affinity purified

Immunogène: EPX antibody was raised using the middle region of EPX corresponding to a region with amino acids LAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSAFFASWRIVYEGGIDP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EPX Blocking Peptide, catalog no. 33R-4765, is also available for use as a blocking control in assays to test for specificity of this EPX antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPX antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EPX

Antigène: EPX (Eosinophil Peroxidase (EPX))

Autre désignation: EPX (EPX Produits)

Synonymes: anticorps EPX, anticorps pmr-1, anticorps EPO, anticorps EPP, anticorps EPX-PEN, anticorps eosinophil peroxidase, anticorps eosinophil peroxidase L homeolog, anticorps LOC788751, anticorps EPX, anticorps epx.L, anticorps Epx

Sujet: EPX belongs to the peroxidase family, XPO subfamily. Defects in EPX are the cause of eosinophil peroxidase deficiency (EPD).

Poids moléculaire: 53 kDa (MW of target protein)