F13B anticorps (Middle Region)
-
- Antigène Voir toutes F13B Anticorps
- F13B (Coagulation Factor 13, B Polypeptide (F13B))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp F13B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Factor XIII B Polypeptide antibody was raised against the middle region of F13 B
- Purification
- Affinity purified
- Immunogène
- Factor XIII B Polypeptide antibody was raised using the middle region of F13 B corresponding to a region with amino acids LRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPESP
- Top Product
- Discover our top product F13B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Factor XIII B Polypeptide Blocking Peptide, catalog no. 33R-5367, is also available for use as a blocking control in assays to test for specificity of this Factor XIII B Polypeptide antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of F10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- F13B (Coagulation Factor 13, B Polypeptide (F13B))
- Autre désignation
- Factor XIII B Polypeptide (F13B Produits)
- Synonymes
- anticorps F13B, anticorps coagulation factor XIII B chain, anticorps LOC100347263
- Sujet
- F13B contains 10 Sushi (CCP/SCR) domains. The B chain of factor XIII is not catalytically active, but is thought to stabilize the A subunits and regulate the rate of transglutaminase formation by thrombin. Defects in F13B can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion.
- Poids moléculaire
- 73 kDa (MW of target protein)
-