F13B anticorps (Middle Region)

N° du produit ABIN634019

Détail du produit anti-F13B anticorps

Antigène: F13B (Coagulation Factor 13, B Polypeptide (F13B))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp F13B est non-conjugé

Application: Western Blotting (WB)

Specificité: Factor XIII B Polypeptide antibody was raised against the middle region of F13 B

Purification: Affinity purified

Immunogène: Factor XIII B Polypeptide antibody was raised using the middle region of F13 B corresponding to a region with amino acids LRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPESP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Factor XIII B Polypeptide Blocking Peptide, catalog no. 33R-5367, is also available for use as a blocking control in assays to test for specificity of this Factor XIII B Polypeptide antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of F10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur F13B

Antigène: F13B (Coagulation Factor 13, B Polypeptide (F13B))

Autre désignation: Factor XIII B Polypeptide (F13B Produits)

Synonymes: anticorps F13B, anticorps coagulation factor XIII B chain, anticorps LOC100347263

Sujet: F13B contains 10 Sushi (CCP/SCR) domains. The B chain of factor XIII is not catalytically active, but is thought to stabilize the A subunits and regulate the rate of transglutaminase formation by thrombin. Defects in F13B can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion.

Poids moléculaire: 73 kDa (MW of target protein)