CPB1 anticorps
-
- Antigène Voir toutes CPB1 Anticorps
- CPB1 (Carboxypeptidase B1 (Tissue) (CPB1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CPB1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- Carboxypeptidase B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRVRATGHSYEKYNKWETIEAWTQQVATENPALISRSVIGTTFEGRAIYL
- Top Product
- Discover our top product CPB1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Carboxypeptidase B1 Blocking Peptide, catalog no. 33R-8785, is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CPB1 (Carboxypeptidase B1 (Tissue) (CPB1))
- Autre désignation
- Carboxypeptidase B1 (CPB1 Produits)
- Synonymes
- anticorps wu:fb60d07, anticorps wu:fb69b08, anticorps CPB1, anticorps pCPB, anticorps CPB, anticorps PASP, anticorps PCPB, anticorps Cpb, anticorps 0910001A18Rik, anticorps 1810063F02Rik, anticorps 2210008M23Rik, anticorps AI504870, anticorps carboxypeptidase B1 (tissue), anticorps carboxypeptidase B1, anticorps carboxypeptidase B1 S homeolog, anticorps carboxypeptidase B, anticorps cpb1, anticorps CPB1, anticorps cpb1.S, anticorps CpipJ_CPIJ010799, anticorps CpipJ_CPIJ010801, anticorps VDBG_02663, anticorps LOC100562609, anticorps Cpb1
- Sujet
- Three different procarboxypeptidases A and two different procarboxypeptidases B have been isolated. The B1 and B2 forms differ from each other mainly in isoelectric point. Carboxypeptidase B1 is a highly tissue-specific protein and is a useful serum marker for acute pancreatitis and dysfunction of pancreatic transplants. It is not elevated in pancreatic carcinoma.
- Poids moléculaire
- 35 kDa (MW of target protein)
-