MFAP2 anticorps (N-Term)

N° du produit ABIN634025

Détail du produit anti-MFAP2 anticorps

Antigène: MFAP2 (Microfibrillar Associated Protein 2 (MFAP2))

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MFAP2 est non-conjugé

Application: Western Blotting (WB)

Specificité: MFAP2 antibody was raised against the N terminal of MFAP2

Purification: Affinity purified

Immunogène: MFAP2 antibody was raised using the N terminal of MFAP2 corresponding to a region with amino acids MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MFAP2 Blocking Peptide, catalog no. 33R-6351, is also available for use as a blocking control in assays to test for specificity of this MFAP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFAP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MFAP2

Antigène: MFAP2 (Microfibrillar Associated Protein 2 (MFAP2))

Autre désignation: MFAP2 (MFAP2 Produits)

Synonymes: anticorps MAGP, anticorps MAGP-1, anticorps MAGP1, anticorps AI893631, anticorps Magp, anticorps Magp1, anticorps microfibril associated protein 2, anticorps microfibrillar-associated protein 2, anticorps MFAP2, anticorps Mfap2

Sujet: Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases.

Poids moléculaire: 19 kDa (MW of target protein)