OLFML1 anticorps (N-Term)

N° du produit ABIN634027

Détail du produit anti-OLFML1 anticorps

Antigène: OLFML1 (Olfactomedin-Like 1 (OLFML1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OLFML1 est non-conjugé

Application: Western Blotting (WB)

Specificité: OLFML1 antibody was raised against the N terminal of OLFML1

Purification: Affinity purified

Immunogène: OLFML1 antibody was raised using the N terminal of OLFML1 corresponding to a region with amino acids IYQRFRVLEQGLEKCTQATRAYIQEFQEFSKNISVMLGRCQTYTSEYKSA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OLFML1 Blocking Peptide, catalog no. 33R-4224, is also available for use as a blocking control in assays to test for specificity of this OLFML1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OLFML1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OLFML1

Antigène: OLFML1 (Olfactomedin-Like 1 (OLFML1))

Autre désignation: OLFML1 (OLFML1 Produits)

Synonymes: anticorps UNQ564, anticorps 6720478C22, anticorps AV321997, anticorps BC047207, anticorps MVAL564, anticorps ONT2, anticorps mONT2, anticorps olfactomedin like 1, anticorps olfactomedin-like 1, anticorps OLFML1, anticorps Olfml1

Sujet: The function of OLFML1 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 46 kDa (MW of target protein)