FCN3 anticorps (N-Term)

N° du produit ABIN634029

Détail du produit anti-FCN3 anticorps

Antigène: FCN3 (Ficolin (Collagen/fibrinogen Domain Containing) 3 (Hakata Antigen) (FCN3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FCN3 est non-conjugé

Application: Western Blotting (WB)

Specificité: FCN3 antibody was raised against the N terminal of FCN3

Purification: Affinity purified

Immunogène: FCN3 antibody was raised using the N terminal of FCN3 corresponding to a region with amino acids LEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FCN3 Blocking Peptide, catalog no. 33R-4879, is also available for use as a blocking control in assays to test for specificity of this FCN3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FCN3

Antigène: FCN3 (Ficolin (Collagen/fibrinogen Domain Containing) 3 (Hakata Antigen) (FCN3))

Autre désignation: FCN3 (FCN3 Produits)

Synonymes: anticorps FCNH, anticorps HAKA1, anticorps ficolin 3, anticorps ficolin-3, anticorps FCN3, anticorps Fcn3, anticorps fcn3-A

Sujet: Ficolins are a group of proteins which consist of a collagen-like domain and a fibrinogen-like domain. In human serum, there are two types of ficolins, both of which have lectin activity.

Poids moléculaire: 31 kDa (MW of target protein)

Pathways: Système du Complément