LYZL6 anticorps (N-Term)

N° du produit ABIN634036

Détail du produit anti-LYZL6 anticorps

Antigène: LYZL6 (Lysozyme-Like 6 (LYZL6))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LYZL6 est non-conjugé

Application: Western Blotting (WB)

Specificité: LYZL6 antibody was raised against the N terminal of LYZL6

Purification: Affinity purified

Immunogène: LYZL6 antibody was raised using the N terminal of LYZL6 corresponding to a region with amino acids MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LYZL6 Blocking Peptide, catalog no. 33R-6547, is also available for use as a blocking control in assays to test for specificity of this LYZL6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYZL6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LYZL6

Antigène: LYZL6 (Lysozyme-Like 6 (LYZL6))

Autre désignation: LYZL6 (LYZL6 Produits)

Synonymes: anticorps LYC1, anticorps PRO1485, anticorps TKAL754, anticorps UNQ754, anticorps 1700023H08Rik, anticorps Lyc1, anticorps RGD1306968, anticorps lysozyme like 6, anticorps lysozyme-like protein 6, anticorps lysozyme-like 6, anticorps LYZL6, anticorps LOC480492, anticorps Lyzl6

Sujet: LYZL6 belongs to the glycosyl hydrolase 22 family. The exact function of LYZL6 remains unknown.

Poids moléculaire: 16 kDa (MW of target protein)