CPQ anticorps (N-Term)

N° du produit ABIN634040

Détail du produit anti-CPQ anticorps

Antigène: CPQ (Carboxypeptidase Q (CPQ))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CPQ est non-conjugé

Application: Western Blotting (WB)

Specificité: PGCP antibody was raised against the N terminal of PGCP

Purification: Affinity purified

Immunogène: PGCP antibody was raised using the N terminal of PGCP corresponding to a region with amino acids VDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PGCP Blocking Peptide, catalog no. 33R-9484, is also available for use as a blocking control in assays to test for specificity of this PGCP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGCP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CPQ

Antigène: CPQ (Carboxypeptidase Q (CPQ))

Autre désignation: PGCP (CPQ Produits)

Synonymes: anticorps LDP, anticorps PGCP, anticorps 1190003P12Rik, anticorps 2610034C17Rik, anticorps Hls2, anticorps Lal-1, anticorps Pgcp, anticorps LAL, anticorps lal-1, anticorps MGC80390, anticorps pgcp, anticorps carboxypeptidase Q, anticorps carboxypeptidase Q L homeolog, anticorps CPQ, anticorps Cpq, anticorps cpq.L

Sujet: PGCP is a carboxypeptidase that may play an important role in the hydrolysis of circulating peptides.

Poids moléculaire: 52 kDa (MW of target protein)