CES5A anticorps (N-Term)

N° du produit ABIN634041

Détail du produit anti-CES5A anticorps

Antigène: CES5A (Carboxylesterase 5A (CES5A))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CES5A est non-conjugé

Application: Western Blotting (WB)

Specificité: Carboxylesterase 7 antibody was raised against the N terminal of CES7

Purification: Affinity purified

Immunogène: Carboxylesterase 7 antibody was raised using the N terminal of CES7 corresponding to a region with amino acids SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Carboxylesterase 7 Blocking Peptide, catalog no. 33R-8476, is also available for use as a blocking control in assays to test for specificity of this Carboxylesterase 7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CES7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CES5A

Antigène: CES5A (Carboxylesterase 5A (CES5A))

Autre désignation: Carboxylesterase 7 (CES5A Produits)

Synonymes: anticorps CAUXIN, anticorps CES4C1, anticorps CES5, anticorps CES7, anticorps 1700081L16Rik, anticorps 1700122C07Rik, anticorps BB081581, anticorps Ces7, anticorps Gm503, anticorps cauxin, anticorps Ces5, anticorps LOC445455, anticorps carboxylesterase 5A, anticorps CES5A, anticorps Ces5a

Sujet: CES7 belongs to the type-B carboxylesterase/lipase family. It is involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs.

Poids moléculaire: 58 kDa (MW of target protein)