CES5A anticorps (N-Term)
-
- Antigène Voir toutes CES5A Anticorps
- CES5A (Carboxylesterase 5A (CES5A))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CES5A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Carboxylesterase 7 antibody was raised against the N terminal of CES7
- Purification
- Affinity purified
- Immunogène
- Carboxylesterase 7 antibody was raised using the N terminal of CES7 corresponding to a region with amino acids SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP
- Top Product
- Discover our top product CES5A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Carboxylesterase 7 Blocking Peptide, catalog no. 33R-8476, is also available for use as a blocking control in assays to test for specificity of this Carboxylesterase 7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CES7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CES5A (Carboxylesterase 5A (CES5A))
- Autre désignation
- Carboxylesterase 7 (CES5A Produits)
- Sujet
- CES7 belongs to the type-B carboxylesterase/lipase family. It is involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs.
- Poids moléculaire
- 58 kDa (MW of target protein)
-