CES5A anticorps (N-Term)

N° du produit ABIN634041

Détail du produit anti-CES5A anticorps

Antigène: CES5A (Carboxylesterase 5A (CES5A))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CES5A est non-conjugé

Application: Western Blotting (WB)

Specificité: Carboxylesterase 7 antibody was raised against the N terminal of CES7

Purification: Affinity purified

Immunogène: Carboxylesterase 7 antibody was raised using the N terminal of CES7 corresponding to a region with amino acids SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Carboxylesterase 7 Blocking Peptide, catalog no. 33R-8476, is also available for use as a blocking control in assays to test for specificity of this Carboxylesterase 7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CES7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CES5A

Antigène: CES5A (Carboxylesterase 5A (CES5A))

Autre désignation: Carboxylesterase 7 (CES5A Produits)

Sujet: CES7 belongs to the type-B carboxylesterase/lipase family. It is involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs.

Poids moléculaire: 58 kDa (MW of target protein)