CHAD anticorps (Middle Region)
-
- Antigène Voir toutes CHAD Anticorps
- CHAD (Chondroadherin (CHAD))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CHAD est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Chondroadherin antibody was raised against the middle region of CHAD
- Purification
- Affinity purified
- Immunogène
- Chondroadherin antibody was raised using the middle region of CHAD corresponding to a region with amino acids VDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWL
- Top Product
- Discover our top product CHAD Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Chondroadherin Blocking Peptide, catalog no. 33R-9477, is also available for use as a blocking control in assays to test for specificity of this Chondroadherin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHAD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CHAD (Chondroadherin (CHAD))
- Autre désignation
- Chondroadherin (CHAD Produits)
- Synonymes
- anticorps CHAD, anticorps zgc:63475, anticorps SLRR4A, anticorps chondroadherin, anticorps CHAD, anticorps chad, anticorps Chad
- Sujet
- Chondroadherin is a cartilage matrix protein thought to mediate adhesion of isolated chondrocytes. CHAD contains 11 leucine-rich repeats flanked by cysteine-rich regions. The chondroadherin messenger RNA is present in chondrocytes at all ages.
- Poids moléculaire
- 38 kDa (MW of target protein)
-