BMPER anticorps (C-Term)

N° du produit ABIN634046

Détail du produit anti-BMPER anticorps

Antigène: BMPER (BMP Binding Endothelial Regulator (BMPER))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BMPER est non-conjugé

Application: Western Blotting (WB)

Specificité: BMPER antibody was raised against the C terminal of BMPER

Purification: Affinity purified

Immunogène: BMPER antibody was raised using the C terminal of BMPER corresponding to a region with amino acids NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BMPER Blocking Peptide, catalog no. 33R-6702, is also available for use as a blocking control in assays to test for specificity of this BMPER antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BMPER antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BMPER

Antigène: BMPER (BMP Binding Endothelial Regulator (BMPER))

Autre désignation: BMPER (BMPER Produits)

Synonymes: anticorps BMPER, anticorps CG15671, anticorps CT35855, anticorps Cv 2, anticorps Cv-2, anticorps Cv2, anticorps Dmel\\CG15671, anticorps cv 2, anticorps CV2, anticorps cv-2, anticorps crim3, anticorps cv2, anticorps cvl2, anticorps id:ibd5071, anticorps CV-2, anticorps CRIM3, anticorps 3110056H04Rik, anticorps Crim3, anticorps RGD1563373, anticorps BMP binding endothelial regulator, anticorps crossveinless 2, anticorps BMP-binding endothelial regulator protein, anticorps BMP binding endothelial regulator L homeolog, anticorps BMP-binding endothelial regulator, anticorps BMPER, anticorps cv-2, anticorps bmper, anticorps LOC100070275, anticorps cv2, anticorps bmper.L, anticorps Bmper

Sujet: BMPER contains 1 TIL (trypsin inhibitory-like) domain, 5 VWFC domains and 1 VWFD domain.BMPER is the inhibitor of bone morphogenetic protein (BMP) functions. It may regulate BMP responsiveness of osteoblasts and chondrocytes.

Poids moléculaire: 76 kDa (MW of target protein)