DHRS9 anticorps
-
- Antigène Voir toutes DHRS9 Anticorps
- DHRS9 (Dehydrogenase/reductase (SDR Family) Member 9 (DHRS9))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DHRS9 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DHRS9 antibody was raised using a synthetic peptide corresponding to a region with amino acids DPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPV
- Top Product
- Discover our top product DHRS9 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DHRS9 Blocking Peptide, catalog no. 33R-2120, is also available for use as a blocking control in assays to test for specificity of this DHRS9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHRS9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DHRS9 (Dehydrogenase/reductase (SDR Family) Member 9 (DHRS9))
- Autre désignation
- DHRS9 (DHRS9 Produits)
- Synonymes
- anticorps 3ALPHA-HSD, anticorps RDH-TBE, anticorps RDH15, anticorps RDHL, anticorps RDHTBE, anticorps RETSDR8, anticorps SDR9C4, anticorps Rdhl, anticorps C730025I08Rik, anticorps Rdh15, anticorps rdhl, anticorps 3alpha-hsd, anticorps rdh15, anticorps retsdr8, anticorps DHRS9, anticorps RDHA, anticorps rdh1l, anticorps wu:fb64b07, anticorps zgc:73286, anticorps dehydrogenase/reductase 9, anticorps dehydrogenase/reductase (SDR family) member 9, anticorps dehydrogenase/reductase (SDR family) member 9 L homeolog, anticorps DHRS9, anticorps Dhrs9, anticorps dhrs9.L, anticorps dhrs9
- Sujet
- DHRS9 is a 3-alpha-hydroxysteroid dehydrogenase that converts 3-alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone.
- Poids moléculaire
- 35 kDa (MW of target protein)
- Pathways
- C21-Steroid Hormone Metabolic Process
-