PCOLCE anticorps (Middle Region)
-
- Antigène Voir toutes PCOLCE Anticorps
- PCOLCE (Procollagen C-Endopeptidase Enhancer (PCOLCE))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PCOLCE est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PCOLCE antibody was raised against the middle region of PCOLCE
- Purification
- Affinity purified
- Immunogène
- PCOLCE antibody was raised using the middle region of PCOLCE corresponding to a region with amino acids LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS
- Top Product
- Discover our top product PCOLCE Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PCOLCE Blocking Peptide, catalog no. 33R-5197, is also available for use as a blocking control in assays to test for specificity of this PCOLCE antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCOLCE antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PCOLCE (Procollagen C-Endopeptidase Enhancer (PCOLCE))
- Autre désignation
- PCOLCE (PCOLCE Produits)
- Synonymes
- anticorps PCPE, anticorps PCPE-1, anticorps PCPE1, anticorps Astt-2, anticorps Astt2, anticorps P14, anticorps procollagen C-endopeptidase enhancer, anticorps procollagen C-endopeptidase enhancer L homeolog, anticorps procollagen C-endopeptidase enhancer protein, anticorps PCOLCE, anticorps Pcolce, anticorps pcolce.L
- Sujet
- PCOLCE binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity.
- Poids moléculaire
- 48 kDa (MW of target protein)
-