RANGAP1 anticorps (N-Term)

N° du produit ABIN634052

Détail du produit anti-RANGAP1 anticorps

Antigène: RANGAP1 (Ran GTPase Activating Protein 1 (RANGAP1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RANGAP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: RanGAP1 antibody was raised against the N terminal of RANGAP1

Purification: Affinity purified

Immunogène: RanGAP1 antibody was raised using the N terminal of RANGAP1 corresponding to a region with amino acids MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RanGAP1 Blocking Peptide, catalog no. 33R-5742, is also available for use as a blocking control in assays to test for specificity of this RanGAP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RANGAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RANGAP1

Antigène: RANGAP1 (Ran GTPase Activating Protein 1 (RANGAP1))

Autre désignation: RanGAP1 (RANGAP1 Produits)

Synonymes: anticorps Fug1, anticorps RANGAP, anticorps SD, anticorps ATRANGAP1, anticorps RAN GTPASE-ACTIVATING PROTEIN 1, anticorps RAN GTPase activating protein 1, anticorps RanGAP1, anticorps fug1, anticorps rangap1b, anticorps rna1p, anticorps C79654, anticorps mKIAA1835, anticorps rangap1, anticorps rangap1a, anticorps Protein rna1, anticorps CG9999, anticorps CT28175, anticorps Dmel\CG9999, anticorps RGP1_DROME, anticorps Ran, anticorps RanGAP, anticorps RanGap, anticorps RanGap1, anticorps Scl, anticorps Sd, anticorps Sd-RanGAP, anticorps Sd-RanGap, anticorps dRanGAP, anticorps ranGAP, anticorps ranGap, anticorps rangap, anticorps zgc:154097, anticorps Ran GTPase activating protein 1, anticorps RAN GTPase activating protein 1, anticorps ran GTPase activating protein 1, anticorps Ran GTPase activating protein 1 S homeolog, anticorps Ran GTPase activating protein 1 L homeolog, anticorps Ran GAP Rna1, anticorps Ran GTPase activating protein, anticorps RAN GTPase activating protein 1a, anticorps RANGAP1, anticorps TERG_02084, anticorps rangap1.S, anticorps Rangap1, anticorps rangap1.L, anticorps rna1, anticorps RanGAP, anticorps rangap1a

Sujet: RanGAP1, is a homodimeric 65 kDa polypeptide that specifically induces the GTPase activity of RAN, but not of RAS by over 1,000-fold. RanGAP1 is the immediate antagonist of RCC1, a regulator molecule that keeps RAN in the active, GTP-bound state.

Poids moléculaire: 63 kDa (MW of target protein)

Pathways: M Phase, Protein targeting to Nucleus