KLHDC4 anticorps (N-Term)
-
- Antigène Tous les produits KLHDC4
- KLHDC4 (Kelch Domain Containing 4 (KLHDC4))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KLHDC4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KLHDC4 antibody was raised against the N terminal of KLHDC4
- Purification
- Affinity purified
- Immunogène
- KLHDC4 antibody was raised using the N terminal of KLHDC4 corresponding to a region with amino acids MGKKGKKEKKGRGAEKTAAKMEKKVSKRSRKEEEDLEALIAHFQTLDAKR
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KLHDC4 Blocking Peptide, catalog no. 33R-6041, is also available for use as a blocking control in assays to test for specificity of this KLHDC4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KLHDC4 (Kelch Domain Containing 4 (KLHDC4))
- Autre désignation
- KLHDC4 (KLHDC4 Produits)
- Synonymes
- anticorps AA408426, anticorps AV352552, anticorps BC012312, anticorps G430025P05Rik, anticorps MGC53395, anticorps fb95f04, anticorps wu:fb95f04, anticorps RGD1561676, anticorps kelch domain containing 4, anticorps kelch domain containing 4 L homeolog, anticorps KLHDC4, anticorps Klhdc4, anticorps klhdc4.L, anticorps klhdc4
- Sujet
- KLHDC4 is involved in protein binding.
- Poids moléculaire
- 58 kDa (MW of target protein)
-