KLHDC4 anticorps (N-Term)

N° du produit ABIN634055

Détail du produit anti-KLHDC4 anticorps

Antigène: KLHDC4 (Kelch Domain Containing 4 (KLHDC4))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KLHDC4 est non-conjugé

Application: Western Blotting (WB)

Specificité: KLHDC4 antibody was raised against the N terminal of KLHDC4

Purification: Affinity purified

Immunogène: KLHDC4 antibody was raised using the N terminal of KLHDC4 corresponding to a region with amino acids MGKKGKKEKKGRGAEKTAAKMEKKVSKRSRKEEEDLEALIAHFQTLDAKR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KLHDC4 Blocking Peptide, catalog no. 33R-6041, is also available for use as a blocking control in assays to test for specificity of this KLHDC4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KLHDC4

Antigène: KLHDC4 (Kelch Domain Containing 4 (KLHDC4))

Autre désignation: KLHDC4 (KLHDC4 Produits)

Synonymes: anticorps AA408426, anticorps AV352552, anticorps BC012312, anticorps G430025P05Rik, anticorps MGC53395, anticorps fb95f04, anticorps wu:fb95f04, anticorps RGD1561676, anticorps kelch domain containing 4, anticorps kelch domain containing 4 L homeolog, anticorps KLHDC4, anticorps Klhdc4, anticorps klhdc4.L, anticorps klhdc4

Sujet: KLHDC4 is involved in protein binding.

Poids moléculaire: 58 kDa (MW of target protein)