LCN12 anticorps (N-Term)

N° du produit ABIN634058

Détail du produit anti-LCN12 anticorps

Antigène: LCN12 (Lipocalin 12 (LCN12))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LCN12 est non-conjugé

Application: Western Blotting (WB)

Specificité: Lipocalin 12 antibody was raised against the N terminal of LCN12

Purification: Affinity purified

Immunogène: Lipocalin 12 antibody was raised using the N terminal of LCN12 corresponding to a region with amino acids GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Lipocalin 12 Blocking Peptide, catalog no. 33R-3454, is also available for use as a blocking control in assays to test for specificity of this Lipocalin 12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCN12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LCN12

Antigène: LCN12 (Lipocalin 12 (LCN12))

Autre désignation: Lipocalin 12 (LCN12 Produits)

Synonymes: anticorps 9230102M18Rik, anticorps lipocalin 12, anticorps LCN12, anticorps Lcn12

Sujet: LCN12 may play a role in male fertility. LCN12 may act as a retinoid carrier protein within the epididymis.

Poids moléculaire: 39 kDa (MW of target protein)