HS3ST1 anticorps
-
- Antigène Voir toutes HS3ST1 Anticorps
- HS3ST1 (Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 1 (HS3ST1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HS3ST1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- HS3 ST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV
- Top Product
- Discover our top product HS3ST1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HS3ST1 Blocking Peptide, catalog no. 33R-9139, is also available for use as a blocking control in assays to test for specificity of this HS3ST1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 T1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HS3ST1 (Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 1 (HS3ST1))
- Autre désignation
- HS3ST1 (HS3ST1 Produits)
- Synonymes
- anticorps 3OST1, anticorps 3OST, anticorps 3-Ost, anticorps D5Wsu110e, anticorps Hsg3ost, anticorps heparan sulfate-glucosamine 3-sulfotransferase 1 L homeolog, anticorps heparan sulfate-glucosamine 3-sulfotransferase 1, anticorps heparan sulfate (glucosamine) 3-O-sulfotransferase 1, anticorps hs3st1.L, anticorps HS3ST1, anticorps hs3st1, anticorps Hs3st1
- Sujet
- HS3ST1 is the rate limiting enzyme for synthesis of HSact. HS3ST1 performs the crucial step modification in the biosynthesis of anticoagulant heparan sulfate (HSact) that is to complete the structure of the antithrombin pentasaccharide binding site.Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities.
- Poids moléculaire
- 34 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-