Dynamitin anticorps
-
- Antigène Voir toutes Dynamitin (DCTN2) Anticorps
- Dynamitin (DCTN2) (Dynactin 2 (p50) (DCTN2))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Dynamitin est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- Dynactin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAFAQELEELTSTSVEHI
- Top Product
- Discover our top product DCTN2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Dynactin 2 Blocking Peptide, catalog no. 33R-1100, is also available for use as a blocking control in assays to test for specificity of this Dynactin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCTN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Dynamitin (DCTN2) (Dynactin 2 (p50) (DCTN2))
- Autre désignation
- Dynactin 2 (DCTN2 Produits)
- Synonymes
- anticorps DCTN2, anticorps dctn2, anticorps dctn50, anticorps dynamitin, anticorps rbp50, anticorps CG8269, anticorps DMN, anticorps Dmel\\CG8269, anticorps P50, anticorps dDyn, anticorps dmn, anticorps dyna, anticorps l(2)k16109, anticorps l(2)k16218, anticorps p50, anticorps p50/Dmn, anticorps p50/dynamitin, anticorps 2310042E05Rik, anticorps C130077D06Rik, anticorps C87049, anticorps DCTN-50, anticorps GMP23-48K, anticorps RBP50, anticorps DCTN50, anticorps DYNAMITIN, anticorps zgc:63867, anticorps dynactin subunit 2, anticorps dynactin subunit 2 S homeolog, anticorps Dynactin 2, p50 subunit, anticorps dynactin 2, anticorps dynactin 2 (p50), anticorps dynactin subunit 2 L homeolog, anticorps DCTN2, anticorps dctn2.S, anticorps DCTN2-p50, anticorps dctn2, anticorps Dctn2, anticorps dctn2.L
- Sujet
- DCTN2 is a 50 kDa subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kDa. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis.
- Poids moléculaire
- 45 kDa (MW of target protein)
- Pathways
- M Phase, Ribonucleoprotein Complex Subunit Organization
-